Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (18 species) not a true protein |
Species Branchiostoma floridae [TaxId:7739] [226665] (2 PDB entries) |
Domain d4dkna_: 4dkn A: [219841] automated match to d2c9ja_ |
PDB Entry: 4dkn (more details), 1.35 Å
SCOPe Domain Sequences for d4dkna_:
Sequence, based on SEQRES records: (download)
>d4dkna_ d.22.1.0 (A:) automated matches {Branchiostoma floridae [TaxId: 7739]} plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf sadlmkkqpvfvyrkchvkatktevtlderekafyela
>d4dkna_ d.22.1.0 (A:) automated matches {Branchiostoma floridae [TaxId: 7739]} plpathdihlhgsinghefdmvgggkgdpnagslvttakstkgalkfspylmiphlgygy yqylpypdgpspfqvsmlegsgyavyrvfdfedggklstefkysyegshikadmklmgsg fpddgpvmtsqivdqdgcvskktylnnntivdsfdwsynlqngkryrarvsshyifdkpf kqpvfvyrkchvkatktevtlderekafyela
Timeline for d4dkna_: