Lineage for d4dkmh_ (4dkm H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940686Species Branchiostoma floridae [TaxId:7739] [226665] (5 PDB entries)
  8. 2940710Domain d4dkmh_: 4dkm H: [219840]
    automated match to d2rh7a1

Details for d4dkmh_

PDB Entry: 4dkm (more details), 1.95 Å

PDB Description: Crystal Structure of Amphioxus GFPc1a
PDB Compounds: (H:) Amphioxus Green Fluorescent Protein, GFPc1a

SCOPe Domain Sequences for d4dkmh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dkmh_ d.22.1.0 (H:) automated matches {Branchiostoma floridae [TaxId: 7739]}
lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
atilqkqpmfvfrktevkasdaeinlkewqkafhdl

SCOPe Domain Coordinates for d4dkmh_:

Click to download the PDB-style file with coordinates for d4dkmh_.
(The format of our PDB-style files is described here.)

Timeline for d4dkmh_: