Lineage for d4dkmd_ (4dkm D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547743Species Branchiostoma floridae [TaxId:7739] [226665] (5 PDB entries)
  8. 2547763Domain d4dkmd_: 4dkm D: [219836]
    automated match to d2rh7a1

Details for d4dkmd_

PDB Entry: 4dkm (more details), 1.95 Å

PDB Description: Crystal Structure of Amphioxus GFPc1a
PDB Compounds: (D:) Amphioxus Green Fluorescent Protein, GFPc1a

SCOPe Domain Sequences for d4dkmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dkmd_ d.22.1.0 (D:) automated matches {Branchiostoma floridae [TaxId: 7739]}
lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
atilqkqpmfvfrktevkasdaeinlkewqkafhdl

SCOPe Domain Coordinates for d4dkmd_:

Click to download the PDB-style file with coordinates for d4dkmd_.
(The format of our PDB-style files is described here.)

Timeline for d4dkmd_: