SCOPe 2.03: Domain d4dkmd_: 4dkm D:

Lineage for d4dkmd_ (4dkm D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (17 species)
   not a true protein

7. Species Branchiostoma floridae [TaxId:7739] [226665] (2 PDB entries)

8. Domain d4dkmd_: 4dkm D: [219836]
   automated match to d2rh7a1

Details for d4dkmd_

PDB Entry: 4dkm, 1.95 Å

PDB Description: Crystal Structure of Amphioxus GFPc1a

PDB Compounds: (D:) Amphioxus Green Fluorescent Protein, GFPc1a

SCOPe Domain Sequences for d4dkmd_:

Sequence; same for both SEQRES and ATOM records:

>d4dkmd_ d.22.1.0 (D:) automated matches {Branchiostoma floridae [TaxId: 7739]}
lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
atilqkqpmfvfrktevkasdaeinlkewqkafhdl

Timeline for d4dkmd_:

• d4dkmd_ is new in SCOPe 2.03-stable
  
• d4dkmd_ appears in SCOPe 2.04
  
• d4dkmd_ appears in the current release, SCOPe 2.08