SCOPe 2.04: Domain d4dkmc_: 4dkm C:

Lineage for d4dkmc_ (4dkm C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Branchiostoma floridae [TaxId:7739] [226665] (2 PDB entries)

8. Domain d4dkmc_: 4dkm C: [219835]
   automated match to d2rh7a1

Details for d4dkmc_

PDB Entry: 4dkm, 1.95 Å

PDB Description: Crystal Structure of Amphioxus GFPc1a

PDB Compounds: (C:) Amphioxus Green Fluorescent Protein, GFPc1a

SCOPe Domain Sequences for d4dkmc_:

Sequence; same for both SEQRES and ATOM records:

>d4dkmc_ d.22.1.0 (C:) automated matches {Branchiostoma floridae [TaxId: 7739]}
lptthevhvygsingvefdlvgsgkgnpkdgseeiqvkstkgplgfspyivvpnigygfh
qylpfpdgmspfqaaaddgsgyvvhrtiqfedgasltgnyrysydgghikgefhvvgsgf
padgpvmtksltavdwsvatmlfpndttvvstidwtcpttsgkryhatlrtnytfakpia
atilqkqpmfvfrktevkasdaeinlkewqkafhdl

Timeline for d4dkmc_:

• d4dkmc_ first appeared in SCOPe 2.03
  
• d4dkmc_ appears in SCOPe 2.05
  
• d4dkmc_ appears in the current release, SCOPe 2.08