SCOPe 2.04: Domain d4dkib1: 4dki B:25-138

Lineage for d4dkib1 (4dki B:25-138)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
   some sequence similarity to KSI
   automatically mapped to Pfam PF05223

6. Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries)
   Uniprot O54286 27-668

8. Domain d4dkib1: 4dki B:25-138 [219830]
   Other proteins in same PDB: d4dkia2, d4dkia3, d4dkib2, d4dkib3
   automated match to d1vqqa1
   complexed with bct, cd, cl, rb6

Details for d4dkib1

PDB Entry: 4dki, 2.9 Å

PDB Description: Structural Insights into the Anti- Methicillin-Resistant Staphylococcus aureus (MRSA) Activity of Ceftobiprole

PDB Compounds: (B:) Penicillin-binding protein 2'

SCOPe Domain Sequences for d4dkib1:

Sequence; same for both SEQRES and ATOM records:

>d4dkib1 d.17.4.5 (B:25-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
skdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrk
ikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

Timeline for d4dkib1:

• d4dkib1 first appeared in SCOPe 2.03
  
• d4dkib1 appears in SCOPe 2.05
  
• d4dkib1 appears in the current release, SCOPe 2.08