Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein) some sequence similarity to KSI automatically mapped to Pfam PF05223 |
Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries) Uniprot O54286 27-668 |
Domain d4dkia1: 4dki A:25-138 [219827] Other proteins in same PDB: d4dkia2, d4dkia3, d4dkib2, d4dkib3 automated match to d1vqqa1 complexed with bct, cd, cl, rb6 |
PDB Entry: 4dki (more details), 2.9 Å
SCOPe Domain Sequences for d4dkia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dkia1 d.17.4.5 (A:25-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} skdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrk ikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d4dkia1: