Lineage for d4dkia1 (4dki A:25-138)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405475Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
    automatically mapped to Pfam PF05223
  6. 1405476Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 1405477Species Staphylococcus aureus [TaxId:1280] [82597] (6 PDB entries)
    Uniprot O54286 27-668
  8. 1405484Domain d4dkia1: 4dki A:25-138 [219827]
    Other proteins in same PDB: d4dkia2, d4dkia3, d4dkib2, d4dkib3
    automated match to d1vqqa1
    complexed with bct, cd, cl, rb6

Details for d4dkia1

PDB Entry: 4dki (more details), 2.9 Å

PDB Description: Structural Insights into the Anti- Methicillin-Resistant Staphylococcus aureus (MRSA) Activity of Ceftobiprole
PDB Compounds: (A:) Penicillin-binding protein 2'

SCOPe Domain Sequences for d4dkia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dkia1 d.17.4.5 (A:25-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
skdkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrk
ikkvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d4dkia1:

Click to download the PDB-style file with coordinates for d4dkia1.
(The format of our PDB-style files is described here.)

Timeline for d4dkia1: