SCOPe 2.08: Domain d4dkfm2: 4dkf M:107-208

Lineage for d4dkfm2 (4dkf M:107-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4dkfm2: 4dkf M:107-208 [219826]
   Other proteins in same PDB: d4dkfl1, d4dkfm1
   automated match to d1dn0a2

Details for d4dkfm2

PDB Entry: 4dkf, 2.61 Å

PDB Description: crystal structure of human interleukin-34 bound to fab2

PDB Compounds: (M:) FAb2 Light Chain

SCOPe Domain Sequences for d4dkfm2:

Sequence, based on SEQRES records:

>d4dkfm2 b.1.1.2 (M:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

Sequence, based on observed residues (ATOM records):

>d4dkfm2 b.1.1.2 (M:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltskadyekhkvyacevthqglsspvtks

Timeline for d4dkfm2:

• d4dkfm2 first appeared in SCOPe 2.03
  
• d4dkfm2 appears in SCOPe 2.07