![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein beta-secretase (memapsin) [50671] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries) Uniprot P56817 58-446 ! Uniprot P56817 60-447 |
![]() | Domain d4djxb_: 4djx B: [219820] automated match to d3l5ea_ complexed with 0kq, tla |
PDB Entry: 4djx (more details), 1.5 Å
SCOPe Domain Sequences for d4djxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4djxb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav sachvhdefrtaavegpfvtldmedcgyn
Timeline for d4djxb_: