SCOPe 2.08: Domain d4djxb_: 4djx B:

Lineage for d4djxb_ (4djx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d4djxb_: 4djx B: [219820]
   automated match to d3l5ea_
   complexed with 0kq, tla

Details for d4djxb_

PDB Entry: 4djx, 1.5 Å

PDB Description: Structure of BACE Bound to 5-(3-(5-chloropyridin-3-yl)phenyl)-5-cyclopropyl-2-imino-3-methylimidazolidin-4-one

PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d4djxb_:

Sequence; same for both SEQRES and ATOM records:

>d4djxb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Timeline for d4djxb_:

• d4djxb_ first appeared in SCOPe 2.03
  
• d4djxb_ appears in SCOPe 2.07