SCOP 1.57: Domain d2mfn_1: 2mfn 1-92

Lineage for d2mfn_1 (2mfn 1-92)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Fibronectin, different Fn3 modules [49270] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49272] (2 PDB entries)

8. Domain d2mfn_1: 2mfn 1-92 [21982]

Details for d2mfn_1

PDB Entry: 2mfn

PDB Description: solution nmr structure of linked cell attachment modules of mouse fibronectin containing the rgd and synergy regions, 10 structures

SCOP Domain Sequences for d2mfn_1:

Sequence; same for both SEQRES and ATOM records:

>d2mfn_1 b.1.2.1 (1-92) Fibronectin, different Fn3 modules {Mouse (Mus musculus)}
gldsptgfdssditansftvhwvaprapitgyiirhhaehsvgrprqdrvppsrnsitlt
nlnpgteyvvsiiavngreesppligqqatvs

Timeline for d2mfn_1:

• d2mfn_1 first appeared (with stable ids) in SCOP 1.55
  
• d2mfn_1 appears in SCOP 1.59
  
• d2mfn_1 appears in the current release, SCOPe 2.08, called d2mfna1