Lineage for d4djmh1 (4djm H:16-152)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764723Family b.1.11.0: automated matches [227286] (1 protein)
    not a true family
  6. 2764724Protein automated matches [227104] (3 species)
    not a true protein
  7. 2764725Species Escherichia coli [TaxId:562] [226555] (1 PDB entry)
  8. 2764733Domain d4djmh1: 4djm H:16-152 [219811]
    Other proteins in same PDB: d4djma2, d4djma3, d4djmb2, d4djmb3, d4djmc2, d4djmc3, d4djmd2, d4djmd3, d4djme2, d4djme3, d4djmf2, d4djmf3, d4djmg2, d4djmg3, d4djmh2, d4djmh3
    automated match to d1p5va1

Details for d4djmh1

PDB Entry: 4djm (more details), 2.52 Å

PDB Description: Crystal structure of the E. coli chaperone DraB
PDB Compounds: (H:) DraB

SCOPe Domain Sequences for d4djmh1:

Sequence, based on SEQRES records: (download)

>d4djmh1 b.1.11.0 (H:16-152) automated matches {Escherichia coli [TaxId: 562]}
etnarvfslhlgatrvvynpassgetltvindqdypmlvqsevlsedqkspapfvvtppl
frldgqqssrlrivrtggefppdreslqwicvkgippkegdrwaegkdgekkadkvslnv
qlsvssciklfvrppav

Sequence, based on observed residues (ATOM records): (download)

>d4djmh1 b.1.11.0 (H:16-152) automated matches {Escherichia coli [TaxId: 562]}
etnarvfslhlgatrvvynpassgetltvindqdypmlvqsevlsedqkspapfvvtppl
frldgqqssrlrivrtggefppdreslqwicvkgippkvslnvqlsvssciklfvrppav

SCOPe Domain Coordinates for d4djmh1:

Click to download the PDB-style file with coordinates for d4djmh1.
(The format of our PDB-style files is described here.)

Timeline for d4djmh1: