SCOPe 2.05: Domain d4djme2: 4djm E:153-237

Lineage for d4djme2 (4djm E:153-237)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.0: automated matches [227280] (1 protein)
   not a true family

6. Protein automated matches [227091] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226556] (2 PDB entries)

8. Domain d4djme2: 4djm E:153-237 [219806]
   Other proteins in same PDB: d4djma1, d4djmb1, d4djmc1, d4djmd1, d4djme1, d4djmf1, d4djmg1, d4djmh1
   automated match to d1p5va2

Details for d4djme2

PDB Entry: 4djm, 2.52 Å

PDB Description: Crystal structure of the E. coli chaperone DraB

PDB Compounds: (E:) DraB

SCOPe Domain Sequences for d4djme2:

Sequence, based on SEQRES records:

>d4djme2 b.7.2.0 (E:153-237) automated matches {Escherichia coli [TaxId: 562]}
kgrpddvagkvewqragnrlkgvnptpfyinlstltvggkevkereyiapfssreyplpa
gasgkvqwkvitdyggtskqfeael

Sequence, based on observed residues (ATOM records):

>d4djme2 b.7.2.0 (E:153-237) automated matches {Escherichia coli [TaxId: 562]}
kgrpddvagkvewqragnrlkgvnptpfyinlstltvggkevkereyiapfssreyplpa
gkvqwkvitdyggtskqfeael

Timeline for d4djme2:

• d4djme2 first appeared in SCOPe 2.03
  
• d4djme2 appears in SCOPe 2.04
  
• d4djme2 appears in SCOPe 2.06
  
• d4djme2 appears in the current release, SCOPe 2.08