![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.0: automated matches [227286] (1 protein) not a true family |
![]() | Protein automated matches [227104] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [226555] (1 PDB entry) |
![]() | Domain d4djmc1: 4djm C:17-152 [219801] Other proteins in same PDB: d4djma2, d4djma3, d4djmb2, d4djmb3, d4djmc2, d4djmc3, d4djmd2, d4djmd3, d4djme2, d4djme3, d4djmf2, d4djmf3, d4djmg2, d4djmg3, d4djmh2, d4djmh3 automated match to d1p5va1 |
PDB Entry: 4djm (more details), 2.52 Å
SCOPe Domain Sequences for d4djmc1:
Sequence, based on SEQRES records: (download)
>d4djmc1 b.1.11.0 (C:17-152) automated matches {Escherichia coli [TaxId: 562]} tnarvfslhlgatrvvynpassgetltvindqdypmlvqsevlsedqkspapfvvtpplf rldgqqssrlrivrtggefppdreslqwicvkgippkegdrwaegkdgekkadkvslnvq lsvssciklfvrppav
>d4djmc1 b.1.11.0 (C:17-152) automated matches {Escherichia coli [TaxId: 562]} tnarvfslhlgatrvvynpassgetltvindqdypmlvqsevlsedqkspapfvvtpplf rldgqqssrlrivrtggefppdreslqwicvkgippvslnvqlsvssciklfvrppav
Timeline for d4djmc1: