SCOPe 2.03: Domain d4djjb_: 4djj B:

Lineage for d4djjb_ (4djj B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (5 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [193327] (6 PDB entries)

8. Domain d4djjb_: 4djj B: [219796]
   automated match to d4jc4a_
   protein/RNA complex; complexed with pml

Details for d4djjb_

PDB Entry: 4djj, 2.94 Å

PDB Description: Crystal structure of the complex of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with Pimelic acid at 2.9 Angstrom resolution

PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4djjb_:

Sequence; same for both SEQRES and ATOM records:

>d4djjb_ c.56.3.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

Timeline for d4djjb_:

• d4djjb_ is new in SCOPe 2.03-stable
  
• d4djjb_ appears in SCOPe 2.04
  
• d4djjb_ appears in the current release, SCOPe 2.08