Lineage for d4dj7e1 (4dj7 E:1-317)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776064Species Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)
  8. 2776070Domain d4dj7e1: 4dj7 E:1-317 [219794]
    Other proteins in same PDB: d4dj7b_, d4dj7d_, d4dj7e2, d4dj7f_
    automated match to d4dj8c_
    complexed with nag

Details for d4dj7e1

PDB Entry: 4dj7 (more details), 2.81 Å

PDB Description: structure of the hemagglutinin complexed with 3sln from a highly pathogenic h7n7 influenza virus
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4dj7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj7e1 b.19.1.2 (E:1-317) automated matches {Influenza A virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslllatgmknvpe

SCOPe Domain Coordinates for d4dj7e1:

Click to download the PDB-style file with coordinates for d4dj7e1.
(The format of our PDB-style files is described here.)

Timeline for d4dj7e1: