Lineage for d4dj7c_ (4dj7 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040743Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)
  8. 2040751Domain d4dj7c_: 4dj7 C: [219793]
    Other proteins in same PDB: d4dj7b_, d4dj7d_, d4dj7e2, d4dj7f_
    automated match to d4dj8c_
    complexed with nag

Details for d4dj7c_

PDB Entry: 4dj7 (more details), 2.81 Å

PDB Description: Structure of the hemagglutinin complexed with 3SLN from a highly pathogenic H7N7 influenza virus
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4dj7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj7c_ b.19.1.2 (C:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
kiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgtit
gppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgir
tngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstte
qtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfnga
fiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryvk
qeslllatgmknvpe

SCOPe Domain Coordinates for d4dj7c_:

Click to download the PDB-style file with coordinates for d4dj7c_.
(The format of our PDB-style files is described here.)

Timeline for d4dj7c_: