Lineage for d4dj7a_ (4dj7 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778537Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)
  8. 1778544Domain d4dj7a_: 4dj7 A: [219792]
    Other proteins in same PDB: d4dj7b_, d4dj7d_, d4dj7f_
    automated match to d4dj8c_
    complexed with nag

Details for d4dj7a_

PDB Entry: 4dj7 (more details), 2.81 Å

PDB Description: structure of the hemagglutinin complexed with 3sln from a highly pathogenic h7n7 influenza virus
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4dj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj7a_ b.19.1.2 (A:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslllatgmknvpe

SCOPe Domain Coordinates for d4dj7a_:

Click to download the PDB-style file with coordinates for d4dj7a_.
(The format of our PDB-style files is described here.)

Timeline for d4dj7a_: