Class b: All beta proteins [48724] (174 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (11 species) not a true protein |
Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries) |
Domain d4dj6e_: 4dj6 E: [219791] automated match to d4dj8c_ complexed with nag |
PDB Entry: 4dj6 (more details), 2.61 Å
SCOPe Domain Sequences for d4dj6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dj6e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]} gdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgt itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysg irtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgst teqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfn gafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpry vkqeslllatgmknvpe
Timeline for d4dj6e_: