SCOPe 2.03: Domain d4dj6e_: 4dj6 E:

Lineage for d4dj6e_ (4dj6 E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (11 species)
   not a true protein

7. Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)

8. Domain d4dj6e_: 4dj6 E: [219791]
   automated match to d4dj8c_
   complexed with nag

Details for d4dj6e_

PDB Entry: 4dj6, 2.61 Å

PDB Description: structure of the hemagglutinin from a highly pathogenic h7n7 influenza virus

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4dj6e_:

Sequence; same for both SEQRES and ATOM records:

>d4dj6e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
gdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysg
irtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgst
teqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfn
gafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpry
vkqeslllatgmknvpe

Timeline for d4dj6e_:

• d4dj6e_ is new in SCOPe 2.03-stable
  
• d4dj6e_ appears in SCOPe 2.04
  
• d4dj6e_ appears in the current release, SCOPe 2.08, called d4dj6e1