Lineage for d4dj6e_ (4dj6 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1306050Protein automated matches [190291] (11 species)
    not a true protein
  7. 1306051Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)
  8. 1306054Domain d4dj6e_: 4dj6 E: [219791]
    automated match to d4dj8c_
    complexed with nag

Details for d4dj6e_

PDB Entry: 4dj6 (more details), 2.61 Å

PDB Description: structure of the hemagglutinin from a highly pathogenic h7n7 influenza virus
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4dj6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj6e_ b.19.1.2 (E:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
gdkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgt
itgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysg
irtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgst
teqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfn
gafiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpry
vkqeslllatgmknvpe

SCOPe Domain Coordinates for d4dj6e_:

Click to download the PDB-style file with coordinates for d4dj6e_.
(The format of our PDB-style files is described here.)

Timeline for d4dj6e_: