Lineage for d2fnba_ (2fnb A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Fibronectin, different Fn3 modules [49270] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49271] (6 PDB entries) 
Domain d2fnba_: 2fnb A: [21979]
Details for d2fnba_
PDB Entry: 2fnb (more details)
PDB Description: nmr structure of the fibronectin ed-b domain, nmr, 20 structures
SCOP Domain Sequences for d2fnba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
mrgsevpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvg
yytvtglepgidydisvitlinggesapttltqqt
SCOP Domain Coordinates for d2fnba_:
Click to download the PDB-style file with coordinates for d2fnba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fnba_:
- d2fnba_ appears in SCOP 1.57
- d2fnba_ appears in the current release, SCOPe 2.08
View in 3D