SCOPe 2.04: Domain d4dirb_: 4dir B:

Lineage for d4dirb_ (4dir B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (37 PDB entries)

8. Domain d4dirb_: 4dir B: [219788]
   automated match to d2y5ie_
   complexed with ca

Details for d4dirb_

PDB Entry: 4dir, 2.6 Å

PDB Description: 2.6 Angstrom X-ray structure of human CA(2+)-S100A5

PDB Compounds: (B:) Protein S100-A5

SCOPe Domain Sequences for d4dirb_:

Sequence, based on SEQRES records:

>d4dirb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etplekalttmvttfhkysgregskltlsrkelkelikkelclgemkessiddlmksldk
nsdqeidfkeysvfltmlcmayndffl

Sequence, based on observed residues (ATOM records):

>d4dirb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etplekalttmvttfhkysgregskltlsrkelkelikkelckessiddlmksldknsdq
eidfkeysvfltmlcmayndffl

Timeline for d4dirb_:

• d4dirb_ first appeared in SCOPe 2.03
  
• d4dirb_ appears in SCOPe 2.05
  
• d4dirb_ appears in the current release, SCOPe 2.08