SCOPe 2.08: Domain d4dilb1: 4dil B:1-250

Lineage for d4dilb1 (4dil B:1-250)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)

6. Protein automated matches [227097] (3 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [226498] (2 PDB entries)

8. Domain d4dilb1: 4dil B:1-250 [219785]
   Other proteins in same PDB: d4dila2, d4dilb2
   automated match to d1vmea2
   complexed with cl, feo; mutant

Details for d4dilb1

PDB Entry: 4dil, 2 Å

PDB Description: Flavo Di-iron protein H90N mutant from Thermotoga maritima

PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d4dilb1:

Sequence; same for both SEQRES and ATOM records:

>d4dilb1 d.157.1.3 (B:1-250) automated matches {Thermotoga maritima [TaxId: 2336]}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdnsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd

Timeline for d4dilb1:

• d4dilb1 first appeared in SCOPe 2.03
  
• d4dilb1 appears in SCOPe 2.07