| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
| Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
| Protein automated matches [191087] (19 species) not a true protein |
| Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries) |
| Domain d4di6f1: 4di6 F:3-169 [219778] Other proteins in same PDB: d4di6a2, d4di6b2, d4di6d2, d4di6e2, d4di6f2 automated match to d1xqia1 |
PDB Entry: 4di6 (more details), 2.4 Å
SCOPe Domain Sequences for d4di6f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4di6f1 d.58.6.0 (F:3-169) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivfrh
seavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfkys
nekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc
Timeline for d4di6f1: