Lineage for d4di6d_ (4di6 D:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) 
Family d.58.6.0: automated matches [191597] (1 protein)
not a true familyProtein automated matches [191087] (10 species)
not a true protein
Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [226296] (2 PDB entries) 
Domain d4di6d_: 4di6 D: [219776]
automated match to d1xqia1
Details for d4di6d_
PDB Entry: 4di6 (more details), 2.4 Å
PDB Description: crystal structure of nucleoside-diphosphate kinase from borrelia burgdorferi
PDB Compounds: (D:) Nucleoside diphosphate kinaseSCOPe Domain Sequences for d4di6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4di6d_ d.58.6.0 (D:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
msmllqktlcivkpdgvrrgligdvvsrfervglkmvaakmlivdeslakkhylyddivf
rhseavwnslikfisnspvftfvvegvesievvrklcgatepklaipgtirgdfsyhsfk
ysnekgfsiynvihasaneadamreipiwfkdneilnykrddecehyyc
SCOPe Domain Coordinates for d4di6d_:
Click to download the PDB-style file with coordinates for d4di6d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4di6d_:
- d4di6d_ first appeared in SCOPe 2.03
- d4di6d_ appears in SCOPe 2.04
- d4di6d_ is called d4di6d1 in SCOPe 2.06
- d4di6d_ appears in the current release, SCOPe 2.08, called d4di6d1
View in 3D
