![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins) automatically mapped to Pfam PF03936 |
![]() | Protein automated matches [227033] (1 species) not a true protein |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (5 PDB entries) |
![]() | Domain d4di5a2: 4di5 A:221-548 [219772] Other proteins in same PDB: d4di5a1 automated match to d1hxga2 complexed with 1ga, act, dpo, mg |
PDB Entry: 4di5 (more details), 2.3 Å
SCOPe Domain Sequences for d4di5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4di5a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty ihnldgythpekvlkphiinllvdsiki
Timeline for d4di5a2: