SCOPe 2.04: Domain d4di5a2: 4di5 A:221-548

Lineage for d4di5a2 (4di5 A:221-548)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins)
   automatically mapped to Pfam PF03936

6. Protein automated matches [227033] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (5 PDB entries)

8. Domain d4di5a2: 4di5 A:221-548 [219772]
   Other proteins in same PDB: d4di5a1
   automated match to d1hxga2
   complexed with 1ga, act, dpo, mg

Details for d4di5a2

PDB Entry: 4di5, 2.3 Å

PDB Description: Co-crystal structure of WT 5-epi-Aristolochene synthase from Nicotiana tobaccum with geraniline

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d4di5a2:

Sequence; same for both SEQRES and ATOM records:

>d4di5a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwalgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkevvrnynvestwfiegytppvseylsnala
tttyyylattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlarivevty
ihnldgythpekvlkphiinllvdsiki

Timeline for d4di5a2:

• d4di5a2 first appeared in SCOPe 2.03
  
• d4di5a2 appears in SCOPe 2.05
  
• d4di5a2 appears in the current release, SCOPe 2.08