SCOPe 2.05: Domain d4di5a1: 4di5 A:14-220

Lineage for d4di5a1 (4di5 A:14-220)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein automated matches [227079] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [226314] (1 PDB entry)

8. Domain d4di5a1: 4di5 A:14-220 [219771]
   Other proteins in same PDB: d4di5a2
   automated match to d1hxga1
   complexed with 1ga, act, dpo, mg

Details for d4di5a1

PDB Entry: 4di5, 2.3 Å

PDB Description: Co-crystal structure of WT 5-epi-Aristolochene synthase from Nicotiana tobaccum with geraniline

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d4di5a1:

Sequence; same for both SEQRES and ATOM records:

>d4di5a1 a.102.4.1 (A:14-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
vrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidt
ierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqden
gkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvtha
leqclhkgvprvetrffissiydkeqs

Timeline for d4di5a1:

• d4di5a1 first appeared in SCOPe 2.03
  
• d4di5a1 appears in SCOPe 2.04
  
• d4di5a1 appears in SCOPe 2.06
  
• d4di5a1 appears in the current release, SCOPe 2.08