![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins) incomplete toroid made of four hairpins automatically mapped to Pfam PF01397 |
![]() | Protein automated matches [227079] (1 species) not a true protein |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [226314] (1 PDB entry) |
![]() | Domain d4di5a1: 4di5 A:14-220 [219771] Other proteins in same PDB: d4di5a2 automated match to d1hxga1 complexed with 1ga, act, dpo, mg |
PDB Entry: 4di5 (more details), 2.3 Å
SCOPe Domain Sequences for d4di5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4di5a1 a.102.4.1 (A:14-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} vrpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidt ierlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqden gkfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvtha leqclhkgvprvetrffissiydkeqs
Timeline for d4di5a1: