| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
| Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
| Protein automated matches [193326] (11 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193327] (9 PDB entries) |
| Domain d4dhwb_: 4dhw B: [219768] automated match to d4jc4a_ complexed with 0l1 |
PDB Entry: 4dhw (more details), 2.43 Å
SCOPe Domain Sequences for d4dhwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhwb_ c.56.3.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka
Timeline for d4dhwb_: