Lineage for d4dhwb_ (4dhw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889282Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2889299Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2889300Protein automated matches [193326] (11 species)
    not a true protein
  7. 2889354Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193327] (9 PDB entries)
  8. 2889362Domain d4dhwb_: 4dhw B: [219768]
    automated match to d4jc4a_
    complexed with 0l1

Details for d4dhwb_

PDB Entry: 4dhw (more details), 2.43 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with Adipic acid at 2.4 Angstrom resolution
PDB Compounds: (B:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4dhwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhwb_ c.56.3.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

SCOPe Domain Coordinates for d4dhwb_:

Click to download the PDB-style file with coordinates for d4dhwb_.
(The format of our PDB-style files is described here.)

Timeline for d4dhwb_: