SCOPe 2.05: Domain d4dhwa_: 4dhw A:

Lineage for d4dhwa_ (4dhw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [193327] (9 PDB entries)

8. Domain d4dhwa_: 4dhw A: [219767]
   automated match to d4jc4a_
   complexed with 0l1

Details for d4dhwa_

PDB Entry: 4dhw, 2.43 Å

PDB Description: Crystal structure of Peptidyl-tRNA hydrolase from Pseudomonas aeruginosa with Adipic acid at 2.4 Angstrom resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4dhwa_:

Sequence; same for both SEQRES and ATOM records:

>d4dhwa_ c.56.3.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv
rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd
iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag
dwtramqklhsqka

Timeline for d4dhwa_:

• d4dhwa_ first appeared in SCOPe 2.03
  
• d4dhwa_ appears in SCOPe 2.04
  
• d4dhwa_ appears in SCOPe 2.06
  
• d4dhwa_ appears in the current release, SCOPe 2.08