Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
Protein automated matches [193326] (7 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [193327] (9 PDB entries) |
Domain d4dhwa_: 4dhw A: [219767] automated match to d4jc4a_ complexed with 0l1 |
PDB Entry: 4dhw (more details), 2.43 Å
SCOPe Domain Sequences for d4dhwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhwa_ c.56.3.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mtavqlivglgnpgpeydqtrhnagalfverlahaqgvslvadrkyfglvgkfshqgkdv rllipttymnrsgqsvaalagffriapdailvahdeldmppgvaklktggghgghnglrd iiaqlgnqnsfhrlrlgighpghsslvsgyvlgraprseqelldtsidfalgvlpemlag dwtramqklhsqka
Timeline for d4dhwa_: