Lineage for d4dhlc1 (4dhl C:7-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764739Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2764758Family b.1.12.0: automated matches [227279] (1 protein)
    not a true family
  6. 2764759Protein automated matches [227090] (1 species)
    not a true protein
  7. 2764760Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (11 PDB entries)
  8. 2764783Domain d4dhlc1: 4dhl C:7-120 [219763]
    Other proteins in same PDB: d4dhla2, d4dhlb2, d4dhlc2, d4dhld2
    automated match to d2qfra1
    complexed with 0k7, edo, fe, gol, nag, so4, zn

Details for d4dhlc1

PDB Entry: 4dhl (more details), 2.3 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with maybridge fragment mo07123
PDB Compounds: (C:) purple acid phosphatase

SCOPe Domain Sequences for d4dhlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhlc1 b.1.12.0 (C:7-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
knrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngr
kriakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d4dhlc1:

Click to download the PDB-style file with coordinates for d4dhlc1.
(The format of our PDB-style files is described here.)

Timeline for d4dhlc1: