Lineage for d1fnha1 (1fnh A:3-92)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) 
Protein Fibronectin, different Fn3 modules [49270] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49271] (6 PDB entries) 
Domain d1fnha1: 1fnh A:3-92 [21976]
Details for d1fnha1
PDB Entry: 1fnh (more details), 2.8 Å
PDB Description: crystal structure of heparin and integrin binding segment of human fibronectin
SCOP Domain Sequences for d1fnha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens)}
paptdlkftqvtptslsaqwtppnvqltgyrvrvtpkektgpmkeinlapdsssvvvsgl
mvatkyevsvyalkdtltsrpaqgvvttle
SCOP Domain Coordinates for d1fnha1:
Click to download the PDB-style file with coordinates for d1fnha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnha1:
- d1fnha1 appears in SCOP 1.57
- d1fnha1 appears in the current release, SCOPe 2.08
View in 3D
