Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (5 PDB entries) |
Domain d4dhid_: 4dhi D: [219758] Other proteins in same PDB: d4dhib_ automated match to d1j7db_ |
PDB Entry: 4dhi (more details), 1.8 Å
SCOPe Domain Sequences for d4dhid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dhid_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla ndvaeqwktneaqaietarawtrlyamnni
Timeline for d4dhid_: