Lineage for d4dhid_ (4dhi D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939083Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (23 PDB entries)
  8. 2939084Domain d4dhid_: 4dhi D: [219758]
    Other proteins in same PDB: d4dhib_
    automated match to d1j7db_

Details for d4dhid_

PDB Entry: 4dhi (more details), 1.8 Å

PDB Description: Structure of C. elegans OTUB1 bound to human UBC13
PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4dhid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dhid_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d4dhid_:

Click to download the PDB-style file with coordinates for d4dhid_.
(The format of our PDB-style files is described here.)

Timeline for d4dhid_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4dhib_