Lineage for d4dgtb_ (4dgt B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896979Species Clostridium difficile [TaxId:272563] [195958] (2 PDB entries)
  8. 2896981Domain d4dgtb_: 4dgt B: [219754]
    automated match to d4dq6b_
    complexed with cl, mg, plp

Details for d4dgtb_

PDB Entry: 4dgt (more details), 1.55 Å

PDB Description: crystal structure of plp-bound putative aminotransferase from clostridium difficile 630 crystallized with magnesium formate
PDB Compounds: (B:) Putative pyridoxal phosphate-dependent transferase

SCOPe Domain Sequences for d4dgtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dgtb_ c.67.1.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]}
nynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleqeiyg
yttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiqepvy
spfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrvwtkd
elkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktfniag
lqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleylesnid
faikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsfgigg
sgyqrinlacprsmleealiriknain

SCOPe Domain Coordinates for d4dgtb_:

Click to download the PDB-style file with coordinates for d4dgtb_.
(The format of our PDB-style files is described here.)

Timeline for d4dgtb_: