Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [195958] (2 PDB entries) |
Domain d4dgta_: 4dgt A: [219753] automated match to d4dq6b_ complexed with cl, mg, plp |
PDB Entry: 4dgt (more details), 1.55 Å
SCOPe Domain Sequences for d4dgta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dgta_ c.67.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} nynfneivdrsnnfsskwsemekkygtndllpmwvadmdfkaapciidslknrleqeiyg yttrpdsynesivnwlyrrhnwkiksewliyspgvipaisllineltkandkimiqepvy spfnsvvknnnreliisplqklengnyimdyedienkikdvklfilcnphnpvgrvwtkd elkklgdiclkhnvkiisdeihsdiilkkhkhipmasiskefekntitcmaptktfniag lqssyvvlpdekdykllddaftridikrnncfslvateasynngeswlesfleylesnid faikyinenmpklkvrkpegtyllwvdfsalglsdeelesilvqkgkvalnqgnsfgigg sgyqrinlacprsmleealiriknain
Timeline for d4dgta_: