Lineage for d4dged_ (4dge D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273757Protein HIV-1 capsid protein [47945] (1 species)
  7. 1273758Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)
  8. 1273803Domain d4dged_: 4dge D: [219750]
    Other proteins in same PDB: d4dgea_, d4dgeb_
    automated match to d4dgac_
    mutant

Details for d4dged_

PDB Entry: 4dge (more details), 2.2 Å

PDB Description: TRIMCyp cyclophilin domain from Macaca mulatta: H70C mutant, HIV-1 CA(O-loop) complex
PDB Compounds: (D:) capsid protein

SCOPe Domain Sequences for d4dged_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dged_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrthppamgplppgqireptgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d4dged_:

Click to download the PDB-style file with coordinates for d4dged_.
(The format of our PDB-style files is described here.)

Timeline for d4dged_: