SCOPe 2.08: Domain d4dg1a1: 4dg1 A:1-429

Lineage for d4dg1a1 (4dg1 A:1-429)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (13 PDB entries)

8. Domain d4dg1a1: 4dg1 A:1-429 [219744]
   Other proteins in same PDB: d4dg1a2, d4dg1b_
   automated match to d1eeta2
   complexed with edo, gol, mg; mutant

Details for d4dg1a1

PDB Entry: 4dg1, 2.15 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase (RT) with polymorphism mutation K172A and K173A

PDB Compounds: (A:) Reverse transcriptase P66 SUBUNIT

SCOPe Domain Sequences for d4dg1a1:

Sequence; same for both SEQRES and ATOM records:

>d4dg1a1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

Timeline for d4dg1a1:

• d4dg1a1 first appeared in SCOPe 2.03
  
• d4dg1a1 appears in SCOPe 2.07