SCOPe 2.08: Domain d4dfpa1: 4dfp A:294-422

Lineage for d4dfpa1 (4dfp A:294-422)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Thermus aquaticus [TaxId:271] [53121] (29 PDB entries)

8. Domain d4dfpa1: 4dfp A:294-422 [219740]
   Other proteins in same PDB: d4dfpa2
   automated match to d1jxea1
   protein/DNA complex; complexed with 0l7, edo, fmt, mg

Details for d4dfpa1

PDB Entry: 4dfp, 2 Å

PDB Description: Crystal structure of the large fragment of DNA Polymerase I from Thermus aqauticus in a ternary complex with 7-(aminopentinyl)-7-deaza-dGTP

PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4dfpa1:

Sequence; same for both SEQRES and ATOM records:

>d4dfpa1 c.55.3.5 (A:294-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus [TaxId: 271]}
leeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkearglla
kdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlf
anlwgrleg

Timeline for d4dfpa1:

• d4dfpa1 first appeared in SCOPe 2.03
  
• d4dfpa1 appears in SCOPe 2.07