Lineage for d4df4a2 (4df4 A:423-832)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1451900Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1451901Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1451967Species Thermus aquaticus [TaxId:271] [56676] (24 PDB entries)
  8. 1451977Domain d4df4a2: 4df4 A:423-832 [219734]
    Other proteins in same PDB: d4df4a1
    automated match to d1jxea2
    protein/DNA complex; complexed with 0l3, edo, mg

Details for d4df4a2

PDB Entry: 4df4 (more details), 2.2 Å

PDB Description: Crystal structure of the large fragment of DNA Polymerase I from Thermus aquaticus in a closed ternary complex with 7-(N-(10-hydroxydecanoyl)-aminopentinyl)-7-deaza-2 -dATP
PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d4df4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4df4a2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d4df4a2:

Click to download the PDB-style file with coordinates for d4df4a2.
(The format of our PDB-style files is described here.)

Timeline for d4df4a2: