Lineage for d4deya2 (4dey A:225-414)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866028Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 2866038Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (5 PDB entries)
    Uniprot P54288 234-451
  8. 2866040Domain d4deya2: 4dey A:225-414 [219732]
    Other proteins in same PDB: d4deya1
    automated match to d1vyua2
    complexed with br

Details for d4deya2

PDB Entry: 4dey (more details), 1.95 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4deya2:

Sequence, based on SEQRES records: (download)

>d4deya2 c.37.1.1 (A:225-414) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrsvlnnpsk
haiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapivvyvki
sspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledacehladyle
aywkathpps

Sequence, based on observed residues (ATOM records): (download)

>d4deya2 c.37.1.1 (A:225-414) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislarsslaevqse
ierifelartlqlvvldadtinhpaqlsktslapivvyvkisspkvlqrliksrgksqak
hlnvqmvaadklaqcppelfdvildenqledacehladyleaywkathpps

SCOPe Domain Coordinates for d4deya2:

Click to download the PDB-style file with coordinates for d4deya2.
(The format of our PDB-style files is described here.)

Timeline for d4deya2: