SCOPe 2.08: Domain d4deya2: 4dey A:225-414

Lineage for d4deya2 (4dey A:225-414)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (5 PDB entries)
   Uniprot P54288 234-451

8. Domain d4deya2: 4dey A:225-414 [219732]
   Other proteins in same PDB: d4deya1
   automated match to d1vyua2
   complexed with br

Details for d4deya2

PDB Entry: 4dey, 1.95 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.

PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4deya2:

Sequence, based on SEQRES records:

>d4deya2 c.37.1.1 (A:225-414) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrsvlnnpsk
haiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapivvyvki
sspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledacehladyle
aywkathpps

Sequence, based on observed residues (ATOM records):

>d4deya2 c.37.1.1 (A:225-414) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislarsslaevqse
ierifelartlqlvvldadtinhpaqlsktslapivvyvkisspkvlqrliksrgksqak
hlnvqmvaadklaqcppelfdvildenqledacehladyleaywkathpps

Timeline for d4deya2:

• d4deya2 first appeared in SCOPe 2.03
  
• d4deya2 appears in SCOPe 2.07