| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries) Uniprot P54288 |
| Domain d4deya1: 4dey A:35-224 [219731] Other proteins in same PDB: d4deya2 automated match to d1vyub1 complexed with br has additional insertions and/or extensions that are not grouped together |
PDB Entry: 4dey (more details), 1.95 Å
SCOPe Domain Sequences for d4deya1:
Sequence, based on SEQRES records: (download)
>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkt
ehtppydvv
>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqraktppydvv
Timeline for d4deya1: