Lineage for d4deya1 (4dey A:35-224)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046122Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 2046132Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
    Uniprot P54288
  8. 2046133Domain d4deya1: 4dey A:35-224 [219731]
    Other proteins in same PDB: d4deya2
    automated match to d1vyub1
    complexed with br

Details for d4deya1

PDB Entry: 4dey (more details), 1.95 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.
PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4deya1:

Sequence, based on SEQRES records: (download)

>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkt
ehtppydvv

Sequence, based on observed residues (ATOM records): (download)

>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqraktppydvv

SCOPe Domain Coordinates for d4deya1:

Click to download the PDB-style file with coordinates for d4deya1.
(The format of our PDB-style files is described here.)

Timeline for d4deya1: