SCOPe 2.08: Domain d4deya1: 4dey A:35-224

Lineage for d4deya1 (4dey A:35-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries)
   Uniprot P54288

8. Domain d4deya1: 4dey A:35-224 [219731]
   Other proteins in same PDB: d4deya2
   automated match to d1vyub1
   complexed with br
   has additional insertions and/or extensions that are not grouped together

Details for d4deya1

PDB Entry: 4dey, 1.95 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav1.2 i-ii linker.

PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4deya1:

Sequence, based on SEQRES records:

>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkt
ehtppydvv

Sequence, based on observed residues (ATOM records):

>d4deya1 b.34.2.1 (A:35-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipspvklenmrlqheqraktppydvv

Timeline for d4deya1:

• d4deya1 first appeared in SCOPe 2.03
  
• d4deya1 appears in SCOPe 2.07