Lineage for d4dexa2 (4dex A:225-413)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109544Protein Guanylate kinase-like domain of the L-type calcium channel [110527] (2 species)
  7. 2109554Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110528] (4 PDB entries)
    Uniprot P54288 234-451
  8. 2109556Domain d4dexa2: 4dex A:225-413 [219730]
    Other proteins in same PDB: d4dexa1
    automated match to d1vyua2

Details for d4dexa2

PDB Entry: 4dex (more details), 2 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4dexa2:

Sequence, based on SEQRES records: (download)

>d4dexa2 c.37.1.1 (A:225-413) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrsvlnnpsk
haiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapivvyvki
sspkvlqrliksrgksqakhlnvqmvaadklaqcppelfdvildenqledacehladyle
aywkathpp

Sequence, based on observed residues (ATOM records): (download)

>d4dexa2 c.37.1.1 (A:225-413) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
psmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislakrsvlnnssl
aevqseierifelartlqlvvldadtinhpaqlsktslapivvyvkisspkvlqrliksr
gksqakhlnvqmvaadklaqcppelfdvildenqledacehladyleaywkathpp

SCOPe Domain Coordinates for d4dexa2:

Click to download the PDB-style file with coordinates for d4dexa2.
(The format of our PDB-style files is described here.)

Timeline for d4dexa2: