Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries) Uniprot P54288 |
Domain d4dexa1: 4dex A:36-224 [219729] Other proteins in same PDB: d4dexa2 automated match to d1vyub1 |
PDB Entry: 4dex (more details), 2 Å
SCOPe Domain Sequences for d4dexa1:
Sequence, based on SEQRES records: (download)
>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkte htppydvv
>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefkltppydvv
Timeline for d4dexa1: