Lineage for d4dexa1 (4dex A:36-224)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310348Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 1310358Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (4 PDB entries)
    Uniprot P54288
  8. 1310360Domain d4dexa1: 4dex A:36-224 [219729]
    Other proteins in same PDB: d4dexa2
    automated match to d1vyub1

Details for d4dexa1

PDB Entry: 4dex (more details), 2 Å

PDB Description: crystal structure of the voltage dependent calcium channel beta-2 subunit in complex with the cav2.2 i-ii linker.
PDB Compounds: (A:) Voltage-dependent L-type calcium channel subunit beta-2

SCOPe Domain Sequences for d4dexa1:

Sequence, based on SEQRES records: (download)

>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh
vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefklhskekrmpffkkte
htppydvv

Sequence, based on observed residues (ATOM records): (download)

>d4dexa1 b.34.2.1 (A:36-224) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
edreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdflh
vkekfnndwwigrlvkegceigfipspvklenmrlqheqrakefkltppydvv

SCOPe Domain Coordinates for d4dexa1:

Click to download the PDB-style file with coordinates for d4dexa1.
(The format of our PDB-style files is described here.)

Timeline for d4dexa1: