SCOPe 2.05: Domain d4deia_: 4dei A:

Lineage for d4deia_ (4dei A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
   PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [103301] (38 PDB entries)

8. Domain d4deia_: 4dei A: [219723]
   automated match to d3i5na_
   complexed with 0jl

Details for d4deia_

PDB Entry: 4dei, 2.05 Å

PDB Description: Crystal structure of c-Met in complex with triazolopyridinone inhibitor 24

PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d4deia_:

Sequence, based on SEQRES records:

>d4deia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
idlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksl
nritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirne
thnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydk
eyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfdi
tvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

Sequence, based on observed residues (ATOM records):

>d4deia_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
idlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldkihcavkslnrig
evsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvk
dligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhn
ktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqg
rrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

Timeline for d4deia_:

• d4deia_ first appeared in SCOPe 2.03
  
• d4deia_ appears in SCOPe 2.04
  
• d4deia_ appears in SCOPe 2.06
  
• d4deia_ appears in the current release, SCOPe 2.08