SCOPe 2.07: Domain d4ddoa2: 4ddo A:262-423

Lineage for d4ddoa2 (4ddo A:262-423)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (63 species)
   not a true protein

7. Species Burkholderia vietnamiensis [TaxId:269482] [226385] (2 PDB entries)

8. Domain d4ddoa2: 4ddo A:262-423 [219708]
   automated match to d1j3na2
   complexed with na

Details for d4ddoa2

PDB Entry: 4ddo, 1.9 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase ii from burkholderia vietnamiensis

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ddoa2:

Sequence; same for both SEQRES and ATOM records:

>d4ddoa2 c.95.1.0 (A:262-423) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
rpiaeiigygttadayhmtagpddgsgamramklalrmgdvapeqvdyvnahatstpvgd
ageiealktvfgvgagpaisstksatghllgaagaieaafsilalrdgvlpgtlnlehpd
paadgldligpaarhvpveialsngfgfggvnasvlfrryps

Timeline for d4ddoa2:

• d4ddoa2 first appeared in SCOPe 2.03
  
• d4ddoa2 appears in SCOPe 2.06