Lineage for d4ddoa2 (4ddo A:262-423)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917500Species Burkholderia vietnamiensis [TaxId:269482] [226385] (2 PDB entries)
  8. 2917506Domain d4ddoa2: 4ddo A:262-423 [219708]
    automated match to d1j3na2
    complexed with na

Details for d4ddoa2

PDB Entry: 4ddo (more details), 1.9 Å

PDB Description: Crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase ii from burkholderia vietnamiensis
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ddoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ddoa2 c.95.1.0 (A:262-423) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
rpiaeiigygttadayhmtagpddgsgamramklalrmgdvapeqvdyvnahatstpvgd
ageiealktvfgvgagpaisstksatghllgaagaieaafsilalrdgvlpgtlnlehpd
paadgldligpaarhvpveialsngfgfggvnasvlfrryps

SCOPe Domain Coordinates for d4ddoa2:

Click to download the PDB-style file with coordinates for d4ddoa2.
(The format of our PDB-style files is described here.)

Timeline for d4ddoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ddoa1