SCOPe 2.07: Domain d1a21b2: 1a21 B:107-208

Lineage for d1a21b2 (1a21 B:107-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)

8. Domain d1a21b2: 1a21 B:107-208 [21970]

Details for d1a21b2

PDB Entry: 1a21, 2.35 Å

PDB Description: tissue factor (tf) from rabbit

PDB Compounds: (B:) tissue factor

SCOPe Domain Sequences for d1a21b2:

Sequence, based on SEQRES records:

>d1a21b2 b.1.2.1 (B:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrasstgkkta
ttntneflidvdkgenycfsvqavipsrkrkqrspesltect

Sequence, based on observed residues (ATOM records):

>d1a21b2 b.1.2.1 (B:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrkktattntn
eflidvdkgenycfsvqavipsrkrkqrspesltect

Timeline for d1a21b2:

• d1a21b2 first appeared (with stable ids) in SCOP 1.55
  
• d1a21b2 appears in SCOPe 2.06
  
• d1a21b2 appears in the current release, SCOPe 2.08