| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry) |
| Domain d1a21b2: 1a21 B:107-208 [21970] |
PDB Entry: 1a21 (more details), 2.35 Å
SCOPe Domain Sequences for d1a21b2:
Sequence, based on SEQRES records: (download)
>d1a21b2 b.1.2.1 (B:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrasstgkkta
ttntneflidvdkgenycfsvqavipsrkrkqrspesltect
>d1a21b2 b.1.2.1 (B:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrkktattntn
eflidvdkgenycfsvqavipsrkrkqrspesltect
Timeline for d1a21b2: