Lineage for d4dd5a1 (4dd5 A:6-274)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (58 species)
    not a true protein
  7. 2147252Species Clostridium difficile [TaxId:272563] [226291] (2 PDB entries)
  8. 2147253Domain d4dd5a1: 4dd5 A:6-274 [219698]
    automated match to d1ulqa1

Details for d4dd5a1

PDB Entry: 4dd5 (more details), 1.25 Å

PDB Description: biosynthetic thiolase (thla1) from clostridium difficile
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4dd5a1:

Sequence, based on SEQRES records: (download)

>d4dd5a1 c.95.1.0 (A:6-274) automated matches {Clostridium difficile [TaxId: 272563]}
mrevviasaartavgsfggafksvsavelgvtaakeaikranitpdmidesllggvltag
lgqniarqialgagipvekpamtinivcgsglrsvsmasqlialgdadimlvggaenmsm
spylvpsarygarmgdaafvdsmikdglsdifnnyhmgitaeniaeqwnitreeqdelal
asqnkaekaqaegkfdeeivpvvikgrkgdtvvdkdeyikpgttmeklaklrpafkkdgt
vtagnasgindgaamlvvmakekaeelgi

Sequence, based on observed residues (ATOM records): (download)

>d4dd5a1 c.95.1.0 (A:6-274) automated matches {Clostridium difficile [TaxId: 272563]}
mrevviasaartavgsfggafksvsavelgvtaakeaikranitpdmidesllggvltag
lgqniarqialgagipvekpamtinivcgsglrsvsmasqlialgdadimlvggaenmsm
spylvpsarygarmgdaafvdsmikdglsdifnnyhmgitaeniaeqwnitreeqdelal
asqnkaekaqaegkfdeeivpvvikdtvvdkdeyikpgttmeklaklrpafkkdgtvtag
nasgindgaamlvvmakekaeelgi

SCOPe Domain Coordinates for d4dd5a1:

Click to download the PDB-style file with coordinates for d4dd5a1.
(The format of our PDB-style files is described here.)

Timeline for d4dd5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dd5a2