SCOPe 2.08: Domain d4dcqa1: 4dcq A:1-115

Lineage for d4dcqa1 (4dcq A:1-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4dcqa1: 4dcq A:1-115 [219686]
   Other proteins in same PDB: d4dcqb_
   automated match to d1aqkl1
   complexed with edo

Details for d4dcqa1

PDB Entry: 4dcq, 1.94 Å

PDB Description: Crystal Structure of the Fab Fragment of 3B5H10, an Antibody-Specific for Extended Polyglutamine Repeats (orthorhombic form)

PDB Compounds: (A:) 3B5H10 FAB light chain

SCOPe Domain Sequences for d4dcqa1:

Sequence; same for both SEQRES and ATOM records:

>d4dcqa1 b.1.1.0 (A:1-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvltqsssasfslgasakltctlnsqhstytiewyqqqplkppkyvmelkkdgshstgdg
ipdrfsgsssgadryllisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlg

Timeline for d4dcqa1:

• d4dcqa1 first appeared in SCOPe 2.03
  
• d4dcqa1 appears in SCOPe 2.07