SCOPe 2.08: Domain d4dcha1: 4dch A:9-218

Lineage for d4dcha1 (4dch A:9-218)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d4dcha1: 4dch A:9-218 [219683]
   Other proteins in same PDB: d4dcha3
   automated match to d1bdga1
   complexed with 4dc, glc, iod

Details for d4dcha1

PDB Entry: 4dch, 1.79 Å

PDB Description: insights into glucokinase activation mechanism: observation of multiple distinct protein conformations

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4dcha1:

Sequence, based on SEQRES records:

>d4dcha1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaakkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpeg
sevgdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyise
cisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrda
ikrrgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records):

>d4dcha1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eaakkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpeg
sevgdflsldlggtnfrvmlvkvgeggqwsvktkhqmysipedamtgtaemlfdyiseci
sdfldkhqmkhkklplgftfsfpnnvvgllrdaikrrgdfemdvvamvndtvatmiscyy
edh

Timeline for d4dcha1:

• d4dcha1 first appeared in SCOPe 2.03
  
• d4dcha1 appears in SCOPe 2.07